PI3 purified MaxPab mouse polyclonal antibody (B01P)
  • PI3 purified MaxPab mouse polyclonal antibody (B01P)

PI3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005266-B01P
PI3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PI3 protein.
Información adicional
Size 50 ug
Gene Name PI3
Gene Alias ESI|MGC13613|SKALP|WAP3|WFDC14|cementoin
Gene Description peptidase inhibitor 3, skin-derived
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PI3 (NP_002629.1, 1 a.a. ~ 117 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5266

Enviar uma mensagem


PI3 purified MaxPab mouse polyclonal antibody (B01P)

PI3 purified MaxPab mouse polyclonal antibody (B01P)