PHF1 monoclonal antibody (M04A), clone 2G7
  • PHF1 monoclonal antibody (M04A), clone 2G7

PHF1 monoclonal antibody (M04A), clone 2G7

Ref: AB-H00005252-M04A
PHF1 monoclonal antibody (M04A), clone 2G7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PHF1.
Información adicional
Size 200 uL
Gene Name PHF1
Gene Alias MTF2L2|PCL1|PHF2
Gene Description PHD finger protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHF1 (NP_077084, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 5252
Clone Number 2G7
Iso type IgG1 Kappa

Enviar uma mensagem


PHF1 monoclonal antibody (M04A), clone 2G7

PHF1 monoclonal antibody (M04A), clone 2G7