PHF1 polyclonal antibody (A01)
  • PHF1 polyclonal antibody (A01)

PHF1 polyclonal antibody (A01)

Ref: AB-H00005252-A01
PHF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PHF1.
Información adicional
Size 50 uL
Gene Name PHF1
Gene Alias MTF2L2|PCL1|PHF2
Gene Description PHD finger protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHF1 (NP_077084, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5252

Enviar uma mensagem


PHF1 polyclonal antibody (A01)

PHF1 polyclonal antibody (A01)