PGK1 polyclonal antibody (A01)
  • PGK1 polyclonal antibody (A01)

PGK1 polyclonal antibody (A01)

Ref: AB-H00005230-A01
PGK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PGK1.
Información adicional
Size 50 uL
Gene Name PGK1
Gene Alias MGC117307|MGC142128|MGC8947|MIG10|PGKA
Gene Description phosphoglycerate kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PGK1 (NP_000282, 321 a.a. ~ 417 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5230

Enviar uma mensagem


PGK1 polyclonal antibody (A01)

PGK1 polyclonal antibody (A01)