PGGT1B polyclonal antibody (A01)
  • PGGT1B polyclonal antibody (A01)

PGGT1B polyclonal antibody (A01)

Ref: AB-H00005229-A01
PGGT1B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PGGT1B.
Información adicional
Size 50 uL
Gene Name PGGT1B
Gene Alias BGGI|GGTI
Gene Description protein geranylgeranyltransferase type I, beta subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MVATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDMLDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PGGT1B (NP_005014, 1 a.a. ~ 105 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5229

Enviar uma mensagem


PGGT1B polyclonal antibody (A01)

PGGT1B polyclonal antibody (A01)