PGF purified MaxPab rabbit polyclonal antibody (D01P)
  • PGF purified MaxPab rabbit polyclonal antibody (D01P)

PGF purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005228-D01P
PGF purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PGF protein.
Información adicional
Size 100 ug
Gene Name PGF
Gene Alias D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760
Gene Description placental growth factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PGF (NP_002623.2, 1 a.a. ~ 170 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5228

Enviar uma mensagem


PGF purified MaxPab rabbit polyclonal antibody (D01P)

PGF purified MaxPab rabbit polyclonal antibody (D01P)