PGD purified MaxPab rabbit polyclonal antibody (D01P)
  • PGD purified MaxPab rabbit polyclonal antibody (D01P)

PGD purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005226-D01P
PGD purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PGD protein.
Información adicional
Size 100 ug
Gene Name PGD
Gene Alias 6PGD
Gene Description phosphogluconate dehydrogenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PGD (NP_002622.2, 1 a.a. ~ 483 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5226

Enviar uma mensagem


PGD purified MaxPab rabbit polyclonal antibody (D01P)

PGD purified MaxPab rabbit polyclonal antibody (D01P)