PGD polyclonal antibody (A01)
  • PGD polyclonal antibody (A01)

PGD polyclonal antibody (A01)

Ref: AB-H00005226-A01
PGD polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PGD.
Información adicional
Size 50 uL
Gene Name PGD
Gene Alias 6PGD
Gene Description phosphogluconate dehydrogenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PGD (AAH00368, 1 a.a. ~ 483 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5226

Enviar uma mensagem


PGD polyclonal antibody (A01)

PGD polyclonal antibody (A01)