PGA5 monoclonal antibody (M02), clone 4G9
  • PGA5 monoclonal antibody (M02), clone 4G9

PGA5 monoclonal antibody (M02), clone 4G9

Ref: AB-H00005222-M02
PGA5 monoclonal antibody (M02), clone 4G9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PGA5.
Información adicional
Size 100 ug
Gene Name PGA5
Gene Alias -
Gene Description pepsinogen 5, group I (pepsinogen A)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq WNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PGA5 (NP_055039, 203 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5222
Clone Number 4G9
Iso type IgG2a Kappa

Enviar uma mensagem


PGA5 monoclonal antibody (M02), clone 4G9

PGA5 monoclonal antibody (M02), clone 4G9