PGA5 purified MaxPab rabbit polyclonal antibody (D01P)
  • PGA5 purified MaxPab rabbit polyclonal antibody (D01P)

PGA5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005222-D01P
PGA5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PGA5 protein.
Información adicional
Size 100 ug
Gene Name PGA5
Gene Alias -
Gene Description pepsinogen 5, group I (pepsinogen A)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKWLLLLGLVALSECIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWEAPTLVDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQIT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PGA5 (NP_055039.1, 1 a.a. ~ 388 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5222

Enviar uma mensagem


PGA5 purified MaxPab rabbit polyclonal antibody (D01P)

PGA5 purified MaxPab rabbit polyclonal antibody (D01P)