PGA5 polyclonal antibody (A01)
  • PGA5 polyclonal antibody (A01)

PGA5 polyclonal antibody (A01)

Ref: AB-H00005222-A01
PGA5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PGA5.
Información adicional
Size 50 uL
Gene Name PGA5
Gene Alias -
Gene Description pepsinogen 5, group I (pepsinogen A)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq WNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PGA5 (NP_055039, 203 a.a. ~ 306 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5222

Enviar uma mensagem


PGA5 polyclonal antibody (A01)

PGA5 polyclonal antibody (A01)