PFN2 monoclonal antibody (M05), clone 6G3
  • PFN2 monoclonal antibody (M05), clone 6G3

PFN2 monoclonal antibody (M05), clone 6G3

Ref: AB-H00005217-M05
PFN2 monoclonal antibody (M05), clone 6G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PFN2.
Información adicional
Size 100 ug
Gene Name PFN2
Gene Alias D3S1319E|PFL
Gene Description profilin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVHGGTLNKKAYELALYLRRSDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PFN2 (NP_002619, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5217
Clone Number 6G3
Iso type IgG2a Kappa

Enviar uma mensagem


PFN2 monoclonal antibody (M05), clone 6G3

PFN2 monoclonal antibody (M05), clone 6G3