PFKP purified MaxPab mouse polyclonal antibody (B01P)
  • PFKP purified MaxPab mouse polyclonal antibody (B01P)

PFKP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005214-B01P
PFKP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PFKP protein.
Información adicional
Size 50 ug
Gene Name PFKP
Gene Alias FLJ40226|PFK-C|PFKF
Gene Description phosphofructokinase, platelet
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPESPPEEGWEEQMCVK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PFKP (NP_002618.1, 1 a.a. ~ 784 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5214

Enviar uma mensagem


PFKP purified MaxPab mouse polyclonal antibody (B01P)

PFKP purified MaxPab mouse polyclonal antibody (B01P)