PFKP polyclonal antibody (A01)
  • PFKP polyclonal antibody (A01)

PFKP polyclonal antibody (A01)

Ref: AB-H00005214-A01
PFKP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PFKP.
Información adicional
Size 50 uL
Gene Name PFKP
Gene Alias FLJ40226|PFK-C|PFKF
Gene Description phosphofructokinase, platelet
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RAMEWITAKLKEARGRGKKFTTDDSICVLGISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQPWS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PFKP (NP_002618, 692 a.a. ~ 783 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5214

Enviar uma mensagem


PFKP polyclonal antibody (A01)

PFKP polyclonal antibody (A01)