PFKM purified MaxPab rabbit polyclonal antibody (D01P)
  • PFKM purified MaxPab rabbit polyclonal antibody (D01P)

PFKM purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005213-D01P
PFKM purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PFKM protein.
Información adicional
Size 100 ug
Gene Name PFKM
Gene Alias GSD7|MGC8699|PFK-1|PFK-M|PFKX
Gene Description phosphofructokinase, muscle
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PFKM (NP_000280.1, 1 a.a. ~ 780 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5213

Enviar uma mensagem


PFKM purified MaxPab rabbit polyclonal antibody (D01P)

PFKM purified MaxPab rabbit polyclonal antibody (D01P)