PFKFB3 purified MaxPab rabbit polyclonal antibody (D01P)
  • PFKFB3 purified MaxPab rabbit polyclonal antibody (D01P)

PFKFB3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005209-D01P
PFKFB3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PFKFB3 protein.
Información adicional
Size 100 ug
Gene Name PFKFB3
Gene Alias IPFK2|PFK2
Gene Description 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PFKFB3 (NP_004557.1, 1 a.a. ~ 520 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5209

Enviar uma mensagem


PFKFB3 purified MaxPab rabbit polyclonal antibody (D01P)

PFKFB3 purified MaxPab rabbit polyclonal antibody (D01P)