PFKFB3 polyclonal antibody (A01)
  • PFKFB3 polyclonal antibody (A01)

PFKFB3 polyclonal antibody (A01)

Ref: AB-H00005209-A01
PFKFB3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PFKFB3.
Información adicional
Size 50 uL
Gene Name PFKFB3
Gene Alias IPFK2|PFK2
Gene Description 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PFKFB3 (NP_004557, 412 a.a. ~ 520 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5209

Enviar uma mensagem


PFKFB3 polyclonal antibody (A01)

PFKFB3 polyclonal antibody (A01)