PFKFB2 MaxPab rabbit polyclonal antibody (D01)
  • PFKFB2 MaxPab rabbit polyclonal antibody (D01)

PFKFB2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005208-D01
PFKFB2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PFKFB2 protein.
Información adicional
Size 100 uL
Gene Name PFKFB2
Gene Alias DKFZp781D2217|MGC138308|MGC138310|PFK-2/FBPase-2
Gene Description 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PFKFB2 (NP_006203.2, 1 a.a. ~ 505 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5208

Enviar uma mensagem


PFKFB2 MaxPab rabbit polyclonal antibody (D01)

PFKFB2 MaxPab rabbit polyclonal antibody (D01)