PEX12 polyclonal antibody (A01)
  • PEX12 polyclonal antibody (A01)

PEX12 polyclonal antibody (A01)

Ref: AB-H00005193-A01
PEX12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PEX12.
Información adicional
Size 50 uL
Gene Name PEX12
Gene Alias PAF-3
Gene Description peroxisomal biogenesis factor 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFDEIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFLVLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLRYILGKAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSALKKAVGGVALSLSTGLSVGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PEX12 (AAH31085, 1 a.a. ~ 359 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5193

Enviar uma mensagem


PEX12 polyclonal antibody (A01)

PEX12 polyclonal antibody (A01)