PEX7 polyclonal antibody (A01)
  • PEX7 polyclonal antibody (A01)

PEX7 polyclonal antibody (A01)

Ref: AB-H00005191-A01
PEX7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PEX7.
Información adicional
Size 50 uL
Gene Name PEX7
Gene Alias PTS2R|RCDP1|RD
Gene Description peroxisomal biogenesis factor 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWDTAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PEX7 (NP_000279, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5191

Enviar uma mensagem


PEX7 polyclonal antibody (A01)

PEX7 polyclonal antibody (A01)