PEX1 purified MaxPab mouse polyclonal antibody (B01P)
  • PEX1 purified MaxPab mouse polyclonal antibody (B01P)

PEX1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005189-B01P
PEX1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PEX1 protein.
Información adicional
Size 50 ug
Gene Name PEX1
Gene Alias ZWS1
Gene Description peroxisomal biogenesis factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWGSDRLAGAGGGGAAVTVAFTNARDCFLHLPRRLVAQLHLLQNQAIEVVWSHQPAFLSWVEGRHFSDQGENVAEINRQVGQKLGLSNGGQVFLKPCSHVVSCQQVEVEPLSADDWEILELHAVSLEQHLLDQIRIVFPKAIFPVWVDQQTYIFIQIVALIPAASYGRLETDTKLLIQPKTRRAKENTFSKADAEYKKLHSYGRDQKGMMKELQTKQLQSNTVGITESNENESEIPVDSSSVASLWTMIGSIFSF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PEX1 (NP_000457.1, 1 a.a. ~ 1283 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5189

Enviar uma mensagem


PEX1 purified MaxPab mouse polyclonal antibody (B01P)

PEX1 purified MaxPab mouse polyclonal antibody (B01P)