PET112L polyclonal antibody (A01)
  • PET112L polyclonal antibody (A01)

PET112L polyclonal antibody (A01)

Ref: AB-H00005188-A01
PET112L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PET112L.
Información adicional
Size 50 uL
Gene Name PET112L
Gene Alias HSPC199|PET112
Gene Description PET112-like (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PET112L (NP_004555, 466 a.a. ~ 556 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5188

Enviar uma mensagem


PET112L polyclonal antibody (A01)

PET112L polyclonal antibody (A01)