SLC26A4 polyclonal antibody (A01)
  • SLC26A4 polyclonal antibody (A01)

SLC26A4 polyclonal antibody (A01)

Ref: AB-H00005172-A01
SLC26A4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC26A4.
Información adicional
Size 50 uL
Gene Name SLC26A4
Gene Alias DFNB4|EVA|PDS
Gene Description solute carrier family 26, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC26A4 (NP_000432, 674 a.a. ~ 754 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5172

Enviar uma mensagem


SLC26A4 polyclonal antibody (A01)

SLC26A4 polyclonal antibody (A01)