PDK2 polyclonal antibody (A01)
  • PDK2 polyclonal antibody (A01)

PDK2 polyclonal antibody (A01)

Ref: AB-H00005164-A01
PDK2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDK2.
Información adicional
Size 50 uL
Gene Name PDK2
Gene Alias PDHK2
Gene Description pyruvate dehydrogenase kinase, isozyme 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDK2 (AAH05811, 187 a.a. ~ 276 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5164

Enviar uma mensagem


PDK2 polyclonal antibody (A01)

PDK2 polyclonal antibody (A01)