PDK1 monoclonal antibody (M02), clone 3E1
  • PDK1 monoclonal antibody (M02), clone 3E1

PDK1 monoclonal antibody (M02), clone 3E1

Ref: AB-H00005163-M02
PDK1 monoclonal antibody (M02), clone 3E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDK1.
Información adicional
Size 100 ug
Gene Name PDK1
Gene Alias -
Gene Description pyruvate dehydrogenase kinase, isozyme 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq GGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDK1 (AAH39158, 203 a.a. ~ 302 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5163
Clone Number 3E1
Iso type IgG1 Kappa

Enviar uma mensagem


PDK1 monoclonal antibody (M02), clone 3E1

PDK1 monoclonal antibody (M02), clone 3E1