PDHB monoclonal antibody (M03), clone 2B2
  • PDHB monoclonal antibody (M03), clone 2B2

PDHB monoclonal antibody (M03), clone 2B2

Ref: AB-H00005162-M03
PDHB monoclonal antibody (M03), clone 2B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDHB.
Información adicional
Size 100 ug
Gene Name PDHB
Gene Alias DKFZp564K0164|PHE1B
Gene Description pyruvate dehydrogenase (lipoamide) beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq LEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDHB (NP_000916, 250 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5162
Clone Number 2B2
Iso type IgG1 Kappa

Enviar uma mensagem


PDHB monoclonal antibody (M03), clone 2B2

PDHB monoclonal antibody (M03), clone 2B2