PDHA2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PDHA2 purified MaxPab rabbit polyclonal antibody (D01P)

PDHA2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005161-D01P
PDHA2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PDHA2 protein.
Información adicional
Size 100 ug
Gene Name PDHA2
Gene Alias MGC149517|MGC149518|PDHAL
Gene Description pyruvate dehydrogenase (lipoamide) alpha 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDHA2 (NP_005381.1, 1 a.a. ~ 388 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5161

Enviar uma mensagem


PDHA2 purified MaxPab rabbit polyclonal antibody (D01P)

PDHA2 purified MaxPab rabbit polyclonal antibody (D01P)