PDGFRB monoclonal antibody (M08), clone 4C12
  • PDGFRB monoclonal antibody (M08), clone 4C12

PDGFRB monoclonal antibody (M08), clone 4C12

Ref: AB-H00005159-M08
PDGFRB monoclonal antibody (M08), clone 4C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDGFRB.
Información adicional
Size 100 ug
Gene Name PDGFRB
Gene Alias CD140B|JTK12|PDGF-R-beta|PDGFR|PDGFR1
Gene Description platelet-derived growth factor receptor, beta polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,IP,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDGFRB (AAH32224, 33 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5159
Clone Number 4C12
Iso type IgG2a Kappa

Enviar uma mensagem


PDGFRB monoclonal antibody (M08), clone 4C12

PDGFRB monoclonal antibody (M08), clone 4C12