PDGFRB purified MaxPab mouse polyclonal antibody (B01P)
  • PDGFRB purified MaxPab mouse polyclonal antibody (B01P)

PDGFRB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005159-B01P
PDGFRB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PDGFRB protein.
Información adicional
Size 50 ug
Gene Name PDGFRB
Gene Alias CD140B|JTK12|PDGF-R-beta|PDGFR|PDGFR1
Gene Description platelet-derived growth factor receptor, beta polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFFGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDGFRB (AAH32224, 1 a.a. ~ 1106 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5159

Enviar uma mensagem


PDGFRB purified MaxPab mouse polyclonal antibody (B01P)

PDGFRB purified MaxPab mouse polyclonal antibody (B01P)