PDGFRA monoclonal antibody (M01), clone 2D2-1A11
  • PDGFRA monoclonal antibody (M01), clone 2D2-1A11

PDGFRA monoclonal antibody (M01), clone 2D2-1A11

Ref: AB-H00005156-M01
PDGFRA monoclonal antibody (M01), clone 2D2-1A11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PDGFRA.
Información adicional
Size 100 ug
Gene Name PDGFRA
Gene Alias CD140A|MGC74795|PDGFR2|Rhe-PDGFRA
Gene Description platelet-derived growth factor receptor, alpha polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDGFRA (AAH15186, 25 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5156
Clone Number 2D2-1A11
Iso type IgG1 kappa

Enviar uma mensagem


PDGFRA monoclonal antibody (M01), clone 2D2-1A11

PDGFRA monoclonal antibody (M01), clone 2D2-1A11