PDE9A monoclonal antibody (M01), clone 1E1
  • PDE9A monoclonal antibody (M01), clone 1E1

PDE9A monoclonal antibody (M01), clone 1E1

Ref: AB-H00005152-M01
PDE9A monoclonal antibody (M01), clone 1E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDE9A.
Información adicional
Size 100 ug
Gene Name PDE9A
Gene Alias HSPDE9A2
Gene Description phosphodiesterase 9A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq EGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE9A (NP_001001567.1, 434 a.a. ~ 533 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5152
Clone Number 1E1
Iso type IgG2a Kappa

Enviar uma mensagem


PDE9A monoclonal antibody (M01), clone 1E1

PDE9A monoclonal antibody (M01), clone 1E1