PDE9A purified MaxPab rabbit polyclonal antibody (D01P)
  • PDE9A purified MaxPab rabbit polyclonal antibody (D01P)

PDE9A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005152-D01P
PDE9A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PDE9A protein.
Información adicional
Size 100 ug
Gene Name PDE9A
Gene Alias HSPDE9A2
Gene Description phosphodiesterase 9A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAMVSIDPTMPANSERTPYKVRPVAIKQLSEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDE9A (NP_001001567.1, 1 a.a. ~ 533 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5152

Enviar uma mensagem


PDE9A purified MaxPab rabbit polyclonal antibody (D01P)

PDE9A purified MaxPab rabbit polyclonal antibody (D01P)