PDE4C monoclonal antibody (M03A), clone 6A10
  • PDE4C monoclonal antibody (M03A), clone 6A10

PDE4C monoclonal antibody (M03A), clone 6A10

Ref: AB-H00005143-M03A
PDE4C monoclonal antibody (M03A), clone 6A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDE4C.
Información adicional
Size 200 uL
Gene Name PDE4C
Gene Alias DPDE1|MGC126222
Gene Description phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERDLSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE4C (NP_000914, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 5143
Clone Number 6A10
Iso type IgG1 Kappa

Enviar uma mensagem


PDE4C monoclonal antibody (M03A), clone 6A10

PDE4C monoclonal antibody (M03A), clone 6A10