PDE4C polyclonal antibody (A01)
  • PDE4C polyclonal antibody (A01)

PDE4C polyclonal antibody (A01)

Ref: AB-H00005143-A01
PDE4C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDE4C.
Información adicional
Size 50 uL
Gene Name PDE4C
Gene Alias DPDE1|MGC126222
Gene Description phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERDLSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE4C (NP_000914, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5143

Enviar uma mensagem


PDE4C polyclonal antibody (A01)

PDE4C polyclonal antibody (A01)