PDE3B monoclonal antibody (M01), clone 4A4
  • PDE3B monoclonal antibody (M01), clone 4A4

PDE3B monoclonal antibody (M01), clone 4A4

Ref: AB-H00005140-M01
PDE3B monoclonal antibody (M01), clone 4A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDE3B.
Información adicional
Size 100 ug
Gene Name PDE3B
Gene Alias HcGIP1|cGIPDE1
Gene Description phosphodiesterase 3B, cGMP-inhibited
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE3B (NP_000913, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5140
Clone Number 4A4
Iso type IgG2a Kappa

Enviar uma mensagem


PDE3B monoclonal antibody (M01), clone 4A4

PDE3B monoclonal antibody (M01), clone 4A4