PDE3B polyclonal antibody (A01)
  • PDE3B polyclonal antibody (A01)

PDE3B polyclonal antibody (A01)

Ref: AB-H00005140-A01
PDE3B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDE3B.
Información adicional
Size 50 uL
Gene Name PDE3B
Gene Alias HcGIP1|cGIPDE1
Gene Description phosphodiesterase 3B, cGMP-inhibited
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDE3B (NP_000913, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5140

Enviar uma mensagem


PDE3B polyclonal antibody (A01)

PDE3B polyclonal antibody (A01)