PDCD1 polyclonal antibody (A01)
  • PDCD1 polyclonal antibody (A01)

PDCD1 polyclonal antibody (A01)

Ref: AB-H00005133-A01
PDCD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDCD1.
Información adicional
Size 50 uL
Gene Name PDCD1
Gene Alias CD279|PD1|SLEB2|hPD-1|hPD-l
Gene Description programmed cell death 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFFPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDCD1 (NP_005009, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5133

Enviar uma mensagem


PDCD1 polyclonal antibody (A01)

PDCD1 polyclonal antibody (A01)