PCTK2 polyclonal antibody (A01)
  • PCTK2 polyclonal antibody (A01)

PCTK2 polyclonal antibody (A01)

Ref: AB-H00005128-A01
PCTK2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCTK2.
Información adicional
Size 50 uL
Gene Name PCTK2
Gene Alias PCTAIRE2
Gene Description PCTAIRE protein kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq NFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCTK2 (NP_002586, 426 a.a. ~ 523 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5128

Enviar uma mensagem


PCTK2 polyclonal antibody (A01)

PCTK2 polyclonal antibody (A01)