PCSK2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PCSK2 purified MaxPab rabbit polyclonal antibody (D01P)

PCSK2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005126-D01P
PCSK2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PCSK2 protein.
Información adicional
Size 100 ug
Gene Name PCSK2
Gene Alias NEC2|PC2|SPC2
Gene Description proprotein convertase subtilisin/kexin type 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PCSK2 (NP_002585.2, 1 a.a. ~ 638 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5126

Enviar uma mensagem


PCSK2 purified MaxPab rabbit polyclonal antibody (D01P)

PCSK2 purified MaxPab rabbit polyclonal antibody (D01P)