PCSK1 monoclonal antibody (M01), clone 2G12
  • PCSK1 monoclonal antibody (M01), clone 2G12

PCSK1 monoclonal antibody (M01), clone 2G12

Ref: AB-H00005122-M01
PCSK1 monoclonal antibody (M01), clone 2G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCSK1.
Información adicional
Size 100 ug
Gene Name PCSK1
Gene Alias BMIQ12|NEC1|PC1|PC3|SPC3
Gene Description proprotein convertase subtilisin/kexin type 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCSK1 (NP_000430, 652 a.a. ~ 753 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5122
Clone Number 2G12
Iso type IgG1 Kappa

Enviar uma mensagem


PCSK1 monoclonal antibody (M01), clone 2G12

PCSK1 monoclonal antibody (M01), clone 2G12