PCOLCE purified MaxPab mouse polyclonal antibody (B01P)
  • PCOLCE purified MaxPab mouse polyclonal antibody (B01P)

PCOLCE purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005118-B01P
PCOLCE purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PCOLCE protein.
Información adicional
Size 50 ug
Gene Name PCOLCE
Gene Alias PCPE|PCPE1
Gene Description procollagen C-endopeptidase enhancer
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGDVKGESGYVASEGFPNLYPPNKECIWTITVPEGQTVSLSFRVFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPLVAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIALTFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAVPGSISSEGNELLVQF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PCOLCE (AAH00574.1, 1 a.a. ~ 449 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5118

Enviar uma mensagem


PCOLCE purified MaxPab mouse polyclonal antibody (B01P)

PCOLCE purified MaxPab mouse polyclonal antibody (B01P)