PCNA monoclonal antibody (M11), clone 3G8
  • PCNA monoclonal antibody (M11), clone 3G8

PCNA monoclonal antibody (M11), clone 3G8

Ref: AB-H00005111-M11
PCNA monoclonal antibody (M11), clone 3G8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PCNA.
Información adicional
Size 100 ug
Gene Name PCNA
Gene Alias MGC8367
Gene Description proliferating cell nuclear antigen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCNA (NP_002583, 78 a.a. ~ 177 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5111
Clone Number 3G8
Iso type IgG2a Kappa

Enviar uma mensagem


PCNA monoclonal antibody (M11), clone 3G8

PCNA monoclonal antibody (M11), clone 3G8