PCNA monoclonal antibody (M05), clone 3A9
  • PCNA monoclonal antibody (M05), clone 3A9

PCNA monoclonal antibody (M05), clone 3A9

Ref: AB-H00005111-M05
PCNA monoclonal antibody (M05), clone 3A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCNA.
Información adicional
Size 100 ug
Gene Name PCNA
Gene Alias MGC8367
Gene Description proliferating cell nuclear antigen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq SHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCNA (NP_002583, 152 a.a. ~ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5111
Clone Number 3A9
Iso type IgG2a Kappa

Enviar uma mensagem


PCNA monoclonal antibody (M05), clone 3A9

PCNA monoclonal antibody (M05), clone 3A9