PCMT1 monoclonal antibody (M02), clone 1D6
  • PCMT1 monoclonal antibody (M02), clone 1D6

PCMT1 monoclonal antibody (M02), clone 1D6

Ref: AB-H00005110-M02
PCMT1 monoclonal antibody (M02), clone 1D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCMT1.
Información adicional
Size 100 ug
Gene Name PCMT1
Gene Alias -
Gene Description protein-L-isoaspartate (D-aspartate) O-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCMT1 (NP_005380, 117 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5110
Clone Number 1D6
Iso type IgG1 Kappa

Enviar uma mensagem


PCMT1 monoclonal antibody (M02), clone 1D6

PCMT1 monoclonal antibody (M02), clone 1D6