PCDH7 polyclonal antibody (A01)
  • PCDH7 polyclonal antibody (A01)

PCDH7 polyclonal antibody (A01)

Ref: AB-H00005099-A01
PCDH7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCDH7.
Información adicional
Size 50 uL
Gene Name PCDH7
Gene Alias BH-Pcdh|BHPCDH
Gene Description protocadherin 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDH7 (NP_002580, 31 a.a. ~ 124 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5099

Enviar uma mensagem


PCDH7 polyclonal antibody (A01)

PCDH7 polyclonal antibody (A01)