PCDH1 polyclonal antibody (A01)
  • PCDH1 polyclonal antibody (A01)

PCDH1 polyclonal antibody (A01)

Ref: AB-H00005097-A01
PCDH1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCDH1.
Información adicional
Size 50 uL
Gene Name PCDH1
Gene Alias FLJ53887|MGC45991|PC42|PCDH42
Gene Description protocadherin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDH1 (NP_002578, 62 a.a. ~ 169 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5097

Enviar uma mensagem


PCDH1 polyclonal antibody (A01)

PCDH1 polyclonal antibody (A01)