PCBP1 polyclonal antibody (A01)
  • PCBP1 polyclonal antibody (A01)

PCBP1 polyclonal antibody (A01)

Ref: AB-H00005093-A01
PCBP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCBP1.
Información adicional
Size 50 uL
Gene Name PCBP1
Gene Alias HNRPE1|HNRPX|hnRNP-E1|hnRNP-X
Gene Description poly(rC) binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCBP1 (AAH39742, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5093

Enviar uma mensagem


PCBP1 polyclonal antibody (A01)

PCBP1 polyclonal antibody (A01)