PCBD1 monoclonal antibody (M01), clone 1G11-H5
  • PCBD1 monoclonal antibody (M01), clone 1G11-H5

PCBD1 monoclonal antibody (M01), clone 1G11-H5

Ref: AB-H00005092-M01
PCBD1 monoclonal antibody (M01), clone 1G11-H5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PCBD1.
Información adicional
Size 100 ug
Gene Name PCBD1
Gene Alias DCOH|PCBD|PCD|PHS
Gene Description pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCBD1 (AAH06324, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5092
Clone Number 1G11-H5
Iso type IgG1 kappa

Enviar uma mensagem


PCBD1 monoclonal antibody (M01), clone 1G11-H5

PCBD1 monoclonal antibody (M01), clone 1G11-H5