PBX2 polyclonal antibody (A01)
  • PBX2 polyclonal antibody (A01)

PBX2 polyclonal antibody (A01)

Ref: AB-H00005089-A01
PBX2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PBX2.
Información adicional
Size 50 uL
Gene Name PBX2
Gene Alias G17|HOX12|PBX2MHC
Gene Description pre-B-cell leukemia homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PBX2 (NP_002577, 354 a.a. ~ 430 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5089

Enviar uma mensagem


PBX2 polyclonal antibody (A01)

PBX2 polyclonal antibody (A01)