PAX9 monoclonal antibody (M13), clone 3B8
  • PAX9 monoclonal antibody (M13), clone 3B8

PAX9 monoclonal antibody (M13), clone 3B8

Ref: AB-H00005083-M13
PAX9 monoclonal antibody (M13), clone 3B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PAX9.
Información adicional
Size 100 ug
Gene Name PAX9
Gene Alias -
Gene Description paired box 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq RSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAX9 (NP_006185, 205 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5083
Clone Number 3B8
Iso type IgG2a Kappa

Enviar uma mensagem


PAX9 monoclonal antibody (M13), clone 3B8

PAX9 monoclonal antibody (M13), clone 3B8